 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
LPERR01G26700.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
| Family |
ERF |
| Protein Properties |
Length: 105aa MW: 11172.9 Da PI: 10.6113 |
| Description |
ERF family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| LPERR01G26700.1 | genome | OGE | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | AP2 | 47.1 | 5.8e-15 | 21 | 62 | 13 | 56 |
AP2 13 grWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
r++AeIrdp+ g +r +lg+fgtaeeAa+a+++a+ +++g+
LPERR01G26700.1 21 RRYAAEIRDPTRHG--ARLWLGTFGTAEEAAAAYDRAAFRMRGA 62
69*******96544..**************************95 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Activates plants defense genes. Can confer resistance to Pseudomonas syringae tomato by potentiating the transcription of a set of pathogenesis related genes, downstream to a defense signaling pathway involving PTO and PRF, but probably independent of ethylene, jasmonate and salicylic acid. {ECO:0000269|PubMed:10607299, ECO:0000269|PubMed:11768541, ECO:0000269|PubMed:11971137}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: The stronger expression mediated by Pseudomonas syringae tomato during an incompatible interaction (avirulent T1 avrPto strain) than during a compatible one (virulent T1 strain) requires the resistance PTO-R as well as the Pseudomonas resistance and fenthion sensitivity (PRF) gene products. This induction is independent of ethylene (ET), jasmonate (JA) and salicylic acid (SA), and subsequent transcription of PTI5 does not require de novo protein synthesis. Also induced by Xanthomonas oryzae strain PXOA avrXa10, by Pseudomonas fluorescens strain 2-79, by PTO and by cycloheximide. Seems to not be influenced by abiotic stresses (ET, SA, JA and wounding). {ECO:0000269|PubMed:10607299, ECO:0000269|PubMed:9878629}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AP003237 | 1e-67 | AP003237.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0046E05. |
| GenBank | AP003249 | 1e-67 | AP003249.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0435B05. |
| GenBank | AP014957 | 1e-67 | AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence. |
