PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

MYB_related

Protein Properties

Length: 244aa MW: 26621.2 Da PI: 10.0975

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kalax.0698s0018.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	45.5	1.7e-14	69	113	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE+++++ + k+ G+g+W+ I++ + k+Rt+ q+ s+ qky Kalax.0698s0018.1.p 69 PWSEEEHKRFLMGLKKVGKGDWRGISKNFVKTRTPTQVASHAQKY 113 8*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.782	62	118	IPR017930	Myb domain
SuperFamily	SSF46689	1.27E-16	64	118	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	7.5E-16	65	116	IPR006447	Myb domain, plants
SMART	SM00717	1.4E-10	66	116	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-11	68	112	IPR009057	Homeodomain-like
CDD	cd00167	1.30E-9	69	114	No hit	No description
Pfam	PF00249	8.0E-12	69	113	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0046686	Biological Process	response to cadmium ion
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 244 aa Download sequence Send to blast
MATEGSKEIM LFGVRIMVDS MRKTASMNNL SDYQHVAESG KGPEAEKPDG YVSDNGGRVG 60 VRERKRGTPW SEEEHKRFLM GLKKVGKGDW RGISKNFVKT RTPTQVASHA QKYFLRHSTV 120 KRRRRNSLFD ITTETVSGKP TEEQREATHG DSGSNSPTAD SSEAVVYPIV PSGPTQMPPP 180 LLAAPISFIY PSQVTQNPMM MILPAPPLTL QPVPLNLSLS LSGYSQTSTN PGLVSKDSYI 240 SVA*

Functional Description ? help Back to Top
Source	Description
UniProt	Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269\|PubMed:21030505}.
UniProt	Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00236	DAP	Transfer from AT1G74840	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.
UniProt	INDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269\|PubMed:21030505}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016169474.1	8e-55	LOW QUALITY PROTEIN: transcription factor MYB1R1-like
Swissprot	Q2V9B0	5e-43	MY1R1_SOLTU; Transcription factor MYB1R1
Swissprot	Q9LVS0	6e-43	KUA1_ARATH; Transcription factor KUA1
TrEMBL	A0A4D8YLN9	5e-55	A0A4D8YLN9_SALSN; Uncharacterized protein
STRING	XP_008374494.1	1e-53	(Malus domestica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G19000.2	1e-41	MYB_related family protein

Link Out ? help Back to Top
Phytozome	Kalax.0698s0018.1.p

Publications ? help Back to Top
Shin D, et al. Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance. Plant Physiol., 2011. 155(1): p. 421-32 [PMID:21030505] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]