PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

MYB

Protein Properties

Length: 156aa MW: 17538.9 Da PI: 10.5113

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kaladp0076s0304.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.5	7.3e-19	21	68	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l ++++q+G g+W+t ++ g+ R++k+c++rw +yl Kaladp0076s0304.1.p 21 KGPWTAEEDLKLREYIEQHGAGNWRTLPENAGLQRCGKSCRLRWTNYL 68 79********************************************97 PP
2	Myb_DNA-binding	55.4	1.4e-17	74	118	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr++ eE+e +++++ lG++ W++Ia++++ gRt++++k++w+++ Kaladp0076s0304.1.p 74 RGRFSFEEEEAIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 118 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.6E-25	15	71	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.576	16	68	IPR017930	Myb domain
SuperFamily	SSF46689	8.24E-32	18	115	IPR009057	Homeodomain-like
SMART	SM00717	3.3E-14	20	70	IPR001005	SANT/Myb domain
Pfam	PF00249	8.9E-17	21	68	IPR001005	SANT/Myb domain
CDD	cd00167	1.47E-11	23	68	No hit	No description
PROSITE profile	PS51294	25.446	69	123	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.7E-27	72	123	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-16	73	121	IPR001005	SANT/Myb domain
Pfam	PF00249	8.2E-16	74	118	IPR001005	SANT/Myb domain
CDD	cd00167	1.25E-11	76	119	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 156 aa Download sequence Send to blast
MGRAPATSSS SSRSSSSGLK KGPWTAEEDL KLREYIEQHG AGNWRTLPEN AGLQRCGKSC 60 RLRWTNYLRP DIKRGRFSFE EEEAIIQLHS VLGNKWSAIA ARLPGRTDNE IKNYWNTHIR 120 KRLLRMGLDP VTHAPRLDHL LGSTSQLSNL SNLLC*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-29	19	123	5	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:19517001, ECO:0000305\|PubMed:12857823}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:12857823, ECO:0000269\|PubMed:19517001, ECO:0000269\|PubMed:8980549}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015953556.1	3e-85	transcription factor MYB102-like
Refseq	XP_016191816.1	3e-85	transcription factor MYB102-like
Refseq	XP_025641079.1	3e-85	transcription factor MYB41
Refseq	XP_025687556.1	3e-85	transcription factor MYB41
Swissprot	Q9LDR8	1e-80	MY102_ARATH; Transcription factor MYB102
TrEMBL	A0A445A5E0	7e-84	A0A445A5E0_ARAHY; Uncharacterized protein
TrEMBL	A0A445E0R7	6e-84	A0A445E0R7_ARAHY; Uncharacterized protein
STRING	XP_008358698.1	2e-81	(Malus domestica)
STRING	XP_009764351.1	7e-82	(Nicotiana sylvestris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G21440.1	6e-81	MYB-like 102

Link Out ? help Back to Top
Phytozome	Kaladp0076s0304.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615] Zhu L,Guo J,Ma Z,Wang J,Zhou C Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis. Biomolecules, 2019. [PMID:29880735]