![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0058s0537.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 258aa MW: 29342.9 Da PI: 6.5047 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 160.9 | 5.1e-50 | 11 | 147 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkk.....leleevikevdiykvePwdLp.k....kvkaeekewyfFskrdkkyatgkrknratks 80 +ppGfrFhPt+eelv +yL+kk++ + ++ +vi ++d++++ePwd+ k +++eekewyf+s++ kky+tg+r+nrat++ Kaladp0058s0537.1.p 11 VPPGFRFHPTEEELVGYYLRKKISMNGnvideCDYLNVIIDIDLCTMEPWDILgKcsqgGAYEEEKEWYFYSHKGKKYPTGSRTNRATAA 100 69*********************999967666666669**************74445554445889************************ PP NAM 81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 g+Wkatg+dk+vls +++++g++ktLvfy+grap+g+ktdW++heyrl Kaladp0058s0537.1.p 101 GFWKATGRDKAVLS-RHQVIGMRKTLVFYHGRAPNGKKTDWIIHEYRL 147 **************.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.11E-55 | 5 | 168 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.643 | 11 | 168 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.1E-26 | 12 | 147 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 258 aa Download sequence Send to blast |
METLSTSSTC VPPGFRFHPT EEELVGYYLR KKISMNGNVI DECDYLNVII DIDLCTMEPW 60 DILGKCSQGG AYEEEKEWYF YSHKGKKYPT GSRTNRATAA GFWKATGRDK AVLSRHQVIG 120 MRKTLVFYHG RAPNGKKTDW IIHEYRLQAY EHGPPQEEGW VVCRAFKKPS PNQQRFSSFL 180 YHADPQLSYT AITPSVSQQQ FHTPSYNFKE YGGCNNQVEL GPEIDGSISA KECLGTDWDQ 240 LSQLQVFPSN LPFDIDV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 1e-43 | 2 | 174 | 11 | 174 | NAC domain-containing protein 19 |
3swm_B | 1e-43 | 2 | 174 | 11 | 174 | NAC domain-containing protein 19 |
3swm_C | 1e-43 | 2 | 174 | 11 | 174 | NAC domain-containing protein 19 |
3swm_D | 1e-43 | 2 | 174 | 11 | 174 | NAC domain-containing protein 19 |
3swp_A | 1e-43 | 2 | 174 | 11 | 174 | NAC domain-containing protein 19 |
3swp_B | 1e-43 | 2 | 174 | 11 | 174 | NAC domain-containing protein 19 |
3swp_C | 1e-43 | 2 | 174 | 11 | 174 | NAC domain-containing protein 19 |
3swp_D | 1e-43 | 2 | 174 | 11 | 174 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20488898, PubMed:22037706, PubMed:21284754). Involved in xylem formation in roots and shoots, especially regulating protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:16103214, PubMed:18445131, PubMed:20488898, PubMed:21498679, PubMed:21284754). Can activate the expression of several genes including XCP1, MYB46, NAC010/SND3, MYB103, MYB58, MYB63, MYB83, KNAT7, ASL19 and ASL20 (PubMed:17890373, PubMed:19088331, PubMed:18952777, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:21284754). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:21284754, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22037706}.; FUNCTION: Required for the soilborne fungal pathogen Verticillium longisporum-induced transdifferentiation of chloroplast-containing bundle sheath cells to functional xylem elements leading to stunted growth, vein clearing, and leaf chloroses, as well as xylem hyperplasia within the vasculature of leaves, hypocotyls, and roots due to reinitiation of cambial activity and transdifferentiation of xylem parenchyma cells. This developmental reprogramming mediates also an increased drought stress tolerance. {ECO:0000269|PubMed:23023171}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214, PubMed:22345435). Up-regulated in a feed-back loop by ASL20 (PubMed:19088331). Levels are monitored by proteasome-mediated degradation (PubMed:18445131). Repressed by WEE1 upon replication stress to prevent premature tracheary element differentiation (PubMed:21498679). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22345435, ECO:0000269|PubMed:23023171}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015057939.1 | 3e-89 | NAC domain-containing protein 30 | ||||
Swissprot | Q9C8W9 | 2e-83 | NAC30_ARATH; NAC domain-containing protein 30 | ||||
TrEMBL | A0A2I4GM41 | 7e-87 | A0A2I4GM41_JUGRE; NAC domain-containing protein 30-like | ||||
TrEMBL | A0A3Q7ITC8 | 7e-87 | A0A3Q7ITC8_SOLLC; Uncharacterized protein | ||||
STRING | Solyc11g018660.1.1 | 1e-87 | (Solanum lycopersicum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71930.1 | 9e-86 | vascular related NAC-domain protein 7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0058s0537.1.p |