PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

bZIP

Protein Properties

Length: 164aa MW: 17405.3 Da PI: 10.3965

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kaladp0058s0058.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	42.1	1.9e-13	76	136	1	61
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 +ke kr +r+ +NR++A+ R+RKka++ Le + ke+e++N++L ++l++l++e + l+ Kaladp0058s0058.1.p 76 DKENKRLKRLLRNRVSAQQARERKKAYLNDLEVRLKEMEKKNSELEEKLSTLQNENQMLRH 136 5899****************************************************98865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PRINTS	PR00041	3.1E-5	6	21	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	3.1E-5	75	91	IPR001630	cAMP response element binding (CREB) protein
SMART	SM00338	2.0E-11	76	140	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	4.0E-12	77	137	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	12.243	78	141	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.5E-12	80	138	No hit	No description
Gene3D	G3DSA:1.20.5.170	2.7E-15	80	140	No hit	No description
CDD	cd14704	1.97E-13	81	132	No hit	No description
PROSITE pattern	PS00036	0	83	98	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	3.1E-5	93	113	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	3.1E-5	113	130	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 164 aa Download sequence Send to blast
MLEQGTSSIP SSSEPSSSSA PPIEVKEGLE SDDEIRKVPE LGGEAGGASG SGAATGTSKA 60 VAEGQSRKRR GRSPADKENK RLKRLLRNRV SAQQARERKK AYLNDLEVRL KEMEKKNSEL 120 EEKLSTLQNE NQMLRHILKN TTASRRGGGG SSGTGCSKAD GPA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2oqq_A	8e-15	101	140	3	42	Transcription factor HY5
2oqq_B	8e-15	101	140	3	42	Transcription factor HY5
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269\|PubMed:15178762}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002308656.1	4e-66	transcription factor HY5
Swissprot	Q9SM50	7e-58	HY5_SOLLC; Transcription factor HY5
TrEMBL	B9HA32	9e-65	B9HA32_POPTR; Uncharacterized protein
STRING	POPTR_0006s26800.1	1e-65	(Populus trichocarpa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11260.1	1e-22	bZIP family protein

Link Out ? help Back to Top
Phytozome	Kaladp0058s0058.1.p

Publications ? help Back to Top
Wang F, et al. Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato. Plant Physiol., 2018. 176(2): p. 1311-1326 [PMID:29146776] Liu CC, et al. The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato. Plant Cell Environ., 2018. 41(8): p. 1762-1775 [PMID:29566255]