PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Kaladp0053s0681.1.p

Organism

Kalanchoe laxiflora

Taxonomic ID

1670617

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

MYB_related

Protein Properties

Length: 89aa MW: 10326 Da PI: 11.3788

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kaladp0053s0681.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47	6.1e-15	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W+++Ed +l d++ G +W++I+++ g+ R +k+c++rw +yl Kaladp0053s0681.1.p 14 RGLWSPDEDRKLRDYIINNGHACWSSIPAKAGLQRNGKSCRLRWINYL 61 789*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.2E-21	6	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.339	9	65	IPR017930	Myb domain
SMART	SM00717	2.6E-9	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	4.7E-13	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.61E-19	16	88	IPR009057	Homeodomain-like
CDD	cd00167	4.94E-8	17	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.6E-7	65	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.402	66	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MGHKPNHQKV KHRRGLWSPD EDRKLRDYII NNGHACWSSI PAKAGLQRNG KSCRLRWINY 60 LRPGLKRGAF TLEEREIVLT LHRMLGNK*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269\|PubMed:11581165, ECO:0000269\|PubMed:19482971}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269\|PubMed:9839469}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020549243.1	9e-43	transcription factor LAF1-like
Swissprot	Q9M0K4	3e-36	LAF1_ARATH; Transcription factor LAF1
TrEMBL	A0A199V6S2	1e-40	A0A199V6S2_ANACO; Transcription factor LAF1 (Fragment)
TrEMBL	A0A2I0VMC8	1e-40	A0A2I0VMC8_9ASPA; Transcription factor LAF1
STRING	EOY23173	2e-41	(Theobroma cacao)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G25560.1	1e-38	myb domain protein 18

Link Out ? help Back to Top
Phytozome	Kaladp0053s0681.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]