PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras

Family

LBD

Protein Properties

Length: 135aa MW: 15332.6 Da PI: 8.6756

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KZV56519.1	genome	CNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	112.5	2.8e-35	10	109	1	100
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 aCaaCk++rr+C+++Cvlap fpa+q+k f+nvh+lFG++n++++l++l+++++ +am+s+ +A +r + PvyG++ i++l+ q++ +++el+++ + KZV56519.1 10 ACAACKYQRRRCTSECVLAPFFPADQMKMFQNVHRLFGVKNIVNTLRELDPDQKAIAMKSMKSQATMRDKYPVYGCLVEIQQLSYQIQLAEEELQAVLQ 108 7*********************************************************************************************99877 PP DUF260 100 e 100 + KZV56519.1 109 Q 109 6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	23.49	9	110	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	8.5E-35	10	106	IPR004883	Lateral organ boundaries, LOB

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009556	Biological Process	microsporogenesis
GO:0009786	Biological Process	regulation of asymmetric cell division
GO:0005634	Cellular Component	nucleus

Sequence ? help Back to Top
Protein Sequence Length: 135 aa Download sequence Send to blast
MTLKSGSGQA CAACKYQRRR CTSECVLAPF FPADQMKMFQ NVHRLFGVKN IVNTLRELDP 60 DQKAIAMKSM KSQATMRDKY PVYGCLVEIQ QLSYQIQLAE EELQAVLQQL AYYRQSQQHC 120 RNSSHASFTA GECPA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	2e-27	6	113	7	114	LOB family transfactor Ramosa2.1
5ly0_B	2e-27	6	113	7	114	LOB family transfactor Ramosa2.1
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KZV56519.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011071735.1	4e-67	LOB domain-containing protein 27
Swissprot	Q9STS6	2e-43	LBD27_ARATH; LOB domain-containing protein 27
TrEMBL	A0A2Z7D9G1	2e-96	A0A2Z7D9G1_9LAMI; LOB domain-containing protein 27
STRING	Migut.D01865.1.p	9e-61	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1449	23	75

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G47870.1	9e-46	LOB domain-containing protein 27

Publications ? help Back to Top
Kim MJ,Kim M,Kim J Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis. Plant Signal Behav, 2015. 10(8): p. e1044193 [PMID:26252070] Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310]