![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV43667.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 119aa MW: 13335.1 Da PI: 8.9749 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 121.4 | 3.9e-38 | 1 | 77 | 17 | 93 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 mk++lP naki+k+ak+t+qec+sefisfvtseas+kc+re+rkt ngdd++wal++lGf++y e ++ yl+++r+ KZV43667.1 1 MKQILPPNAKITKEAKQTMQECASEFISFVTSEASEKCHRENRKTTNGDDICWALCSLGFDRYSEGMSRYLARFRKS 77 9**************************************************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 4.3E-19 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 1.1E-35 | 1 | 87 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.26E-27 | 1 | 83 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 5.7E-16 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.7E-16 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 5.7E-16 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MKQILPPNAK ITKEAKQTMQ ECASEFISFV TSEASEKCHR ENRKTTNGDD ICWALCSLGF 60 DRYSEGMSRY LARFRKSAAS IDTQSEDGRT GGNKLAQPLI FDFGILQKGT NTSPKQTKF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-30 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-30 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV43667.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021673462.1 | 9e-44 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 2e-37 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A2G9IB64 | 5e-42 | A0A2G9IB64_9LAMI; Uncharacterized protein | ||||
STRING | Lus10029908 | 6e-43 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 8e-40 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|