PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV36269.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 108aa MW: 12015 Da PI: 8.2185 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 103.4 | 1.5e-32 | 19 | 100 | 19 | 99 |
NF-YC 19 helPlarikkilk.adedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 h+lPlarikki+k + +dvkmis eaP++++kacelfi elt +w a + krrtl+k d+a av +td+fdflv+ v + KZV36269.1 19 HSLPLARIKKIMKkSGDDVKMISGEAPIVFAKACELFIEELTKTAWEMAVQGKRRTLNKEDVAFAVINTDVFDFLVNLVSDS 100 89**********825689**********************************************************999765 PP | |||||||
2 | NF-YB | 28.7 | 3.2e-09 | 19 | 88 | 6 | 75 |
NF-YB 6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlG 75 + lP+a + +imkk is +a + + fi +t+ a + + + kr+t+n +d+ +a+ + KZV36269.1 19 HSLPLARIKKIMKKSGDDVKMISGEAPIVFAKACELFIEELTKTAWEMAVQGKRRTLNKEDVAFAVINTD 88 579***************9*********99999999***************************9986654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.21E-28 | 15 | 93 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.7E-23 | 20 | 84 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 1.8E-32 | 21 | 97 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MRQPGAYSKL LCGGRTGPHS LPLARIKKIM KKSGDDVKMI SGEAPIVFAK ACELFIEELT 60 KTAWEMAVQG KRRTLNKEDV AFAVINTDVF DFLVNLVSDS DNPRVEEM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 1e-30 | 19 | 97 | 16 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV36269.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014515050.1 | 2e-56 | nuclear transcription factor Y subunit C-1-like | ||||
Swissprot | Q9ZVL3 | 2e-29 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
TrEMBL | A0A2Z7BP83 | 1e-74 | A0A2Z7BP83_9LAMI; Nuclear transcription factor Y subunit C-1-like | ||||
STRING | GLYMA13G35980.1 | 2e-54 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12881 | 17 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54830.3 | 8e-32 | nuclear factor Y, subunit C3 |