![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN539300.1_FGP004 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 162aa MW: 17991.4 Da PI: 7.0849 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 22.7 | 2.4e-07 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd++lv G +W+++++ g KN539300.1_FGP004 14 KGPWTAEEDQKLVSFLLGNGQCCWRAVPKLAG 45 79***************************998 PP | |||||||
2 | Myb_DNA-binding | 31 | 6.1e-10 | 61 | 83 | 24 | 47 |
HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 24 WktIartmgkgRtlkqcksrwqky 47 W++Ia++++ gRt++++k++w+++ KN539300.1_FGP004 61 WSKIASHLP-GRTDNEIKNHWNTH 83 *********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-8 | 5 | 43 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.644 | 9 | 88 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-11 | 13 | 86 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-5 | 14 | 45 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.2E-12 | 14 | 85 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.36E-10 | 16 | 84 | No hit | No description |
Pfam | PF00249 | 1.5E-7 | 61 | 83 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.7E-12 | 61 | 92 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MGRQPCCDKV GLKKGPWTAE EDQKLVSFLL GNGQCCWRAV PKLAGESPTS PEFQSRSLIW 60 WSKIASHLPG RTDNEIKNHW NTHIKKKLRK MGIDPVTHKP LYPAPPLADG GSPEQKVPEE 120 EEVEEKSSAA VESSTSTGAG HDVFCTDEAS FRYMCLAYIH VN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN539300.1_FGP004 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012617 | 1e-141 | CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015610941.1 | 7e-72 | transcription factor MYB20 | ||||
Swissprot | Q9C7U7 | 3e-49 | MYB20_ARATH; Transcription factor MYB20 | ||||
TrEMBL | I1QNT5 | 1e-73 | I1QNT5_ORYGL; Uncharacterized protein | ||||
STRING | ORGLA09G0071400.1 | 2e-74 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66230.1 | 1e-50 | myb domain protein 20 |
Publications ? help Back to Top | |||
---|---|---|---|
|