PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB_related

Protein Properties

Length: 62aa MW: 6664.23 Da PI: 7.36

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KN539257.1_FGP001	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	39.1	1.7e-12	26	61	1	37
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37 rg W + Ede+l ++v+++G+ +W++Ia+++ gR++ KN539257.1_FGP001 26 RGHWRPGEDEKLRQLVEKYGPQNWNSIAEKLE-GRSD 61 899***************************.97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.242	21	62	IPR017930	Myb domain
SuperFamily	SSF46689	3.52E-10	21	61	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.6E-13	23	61	IPR009057	Homeodomain-like
Pfam	PF00249	2.5E-11	26	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.22E-9	29	61	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MASSSTTNTS DGAGKPASSS SSACPRGHWR PGEDEKLRQL VEKYGPQNWN SIAEKLEGRS 60 DI

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KN539257.1_FGP001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC123523	2e-96	AC123523.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0051P13, complete sequence.
GenBank	AF172282	2e-96	AF172282.1 Oryza sativa adh1-adh2 region.
GenBank	AP014967	2e-96	AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBank	CP012619	2e-96	CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015615875.1	2e-35	transcription factor CSA-like
Swissprot	Q6R0C4	2e-15	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A0D3HJE2	1e-37	A0A0D3HJE2_9ORYZ; Uncharacterized protein
STRING	OBART11G06180.1	2e-38	(Oryza barthii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP294	38	260

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	1e-17	myb domain protein 52

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]