PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN539229.1_FGP008 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 168aa MW: 18840.9 Da PI: 6.6287 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 67.2 | 2.1e-21 | 109 | 164 | 1 | 56 |
TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+ qVk+WFqN+R+++k KN539229.1_FGP008 109 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 164 678899***********************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.7E-24 | 90 | 164 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.92E-20 | 95 | 164 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.811 | 106 | 166 | IPR001356 | Homeobox domain |
SMART | SM00389 | 6.6E-15 | 107 | 168 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.49E-19 | 109 | 164 | No hit | No description |
Pfam | PF00046 | 5.0E-19 | 109 | 164 | IPR001356 | Homeobox domain |
PRINTS | PR00031 | 3.0E-5 | 137 | 146 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 141 | 164 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 3.0E-5 | 146 | 162 | IPR000047 | Helix-turn-helix motif |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MTPARRMPPV IGRNGVAYGS PSAQLPLTQA DMLDSHHLQQ ALQQQYFDQI PVTTTAAAAA 60 DSGDNMLHGR ADAGGLVDEF ESKSCSENVD GAGDGLSGDD QDPNQRPRKK RYHRHTQHQI 120 QEMEAFFKEC PHPDDKQRKE LSRELGLEPL QVKFWFQNKR TQMKASIN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in protoderm differentiation and radial pattern formation during early embryogenesis. {ECO:0000269|PubMed:11846882}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN539229.1_FGP008 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB077993 | 0.0 | AB077993.1 Oryza sativa mRNA for Roc1, complete cds. | |||
GenBank | AK120496 | 0.0 | AK120496.1 Oryza sativa Japonica Group cDNA clone:J013120I03, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015650023.1 | 1e-102 | homeobox-leucine zipper protein ROC1 isoform X2 | ||||
Swissprot | Q6ZAR0 | 1e-103 | ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1 | ||||
TrEMBL | A0A0P0XCM0 | 1e-104 | A0A0P0XCM0_ORYSJ; Os08g0187500 protein | ||||
STRING | OS08T0187500-01 | 1e-105 | (Oryza sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP26659 | 5 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G05230.3 | 4e-39 | homeodomain GLABROUS 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|