![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN539135.1_FGP011 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 230aa MW: 25568.6 Da PI: 5.1133 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.6 | 6.7e-14 | 7 | 51 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + ++lG+g+W+ I+r + Rt+ q+ s+ qky KN539135.1_FGP011 7 PWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 51 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.787 | 1 | 56 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.42E-16 | 4 | 57 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.7E-10 | 4 | 54 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 5.9E-19 | 6 | 55 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.5E-11 | 6 | 50 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.9E-11 | 7 | 51 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.05E-9 | 7 | 52 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0030307 | Biological Process | positive regulation of cell growth | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:2000469 | Biological Process | negative regulation of peroxidase activity | ||||
GO:0000976 | Molecular Function | transcription regulatory region sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MTLTGVPWTE EEHRRFLLGL QKLGKGDWRG ISRNFVVSRT PTQVASHAQK YFIRQSNMTR 60 RKRRSSLFDM VPDESMDLPP LPGGQEPETQ VLNQPALPPP REEEEVDSME SDTSAVAESS 120 SASAIMPDNL QSTYPVIVPA YFSPFLQFSV PFWQNQKDED GPVQETHEIV KPVPVHSKSP 180 INVDELVGMS KLSIGESNQE TVSTSLSLNL VGGQNRQSAF HANPPTRAQA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00551 | DAP | Transfer from AT5G47390 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN539135.1_FGP011 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK059716 | 0.0 | AK059716.1 Oryza sativa Japonica Group cDNA clone:001-032-G03, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015614288.1 | 1e-166 | transcription factor MYBS3 | ||||
Swissprot | Q7XC57 | 1e-167 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | A0A0E0BDS9 | 1e-168 | A0A0E0BDS9_9ORYZ; Uncharacterized protein | ||||
STRING | OMERI08G00440.1 | 1e-168 | (Oryza meridionalis) | ||||
STRING | OBART10G18550.1 | 1e-168 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1939 | 37 | 91 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47390.1 | 1e-70 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|