![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN44088.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 186aa MW: 21700.2 Da PI: 6.145 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 63.8 | 3.4e-20 | 3 | 50 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l+++++ +G+++Wkt+a + g++R++k+c++rw++yl KHN44088.1 3 RGAWTPEEDRKLAQCIEIHGPKRWKTVAIKSGLNRCGKSCRLRWLNYL 50 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.3 | 1.3e-16 | 56 | 101 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + eE++l+++++++lG++ W++Ia +++ gRt++++k++w+++l KHN44088.1 56 RGNISDEEEDLILRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 101 7899******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 27.615 | 1 | 54 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.16E-29 | 2 | 97 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-16 | 2 | 52 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-18 | 3 | 50 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-24 | 4 | 57 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.51E-11 | 5 | 50 | No hit | No description |
SMART | SM00717 | 5.0E-14 | 55 | 103 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.161 | 55 | 105 | IPR017930 | Myb domain |
Pfam | PF00249 | 4.4E-15 | 56 | 101 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-25 | 58 | 106 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.72E-10 | 60 | 101 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MNRGAWTPEE DRKLAQCIEI HGPKRWKTVA IKSGLNRCGK SCRLRWLNYL RPNIKRGNIS 60 DEEEDLILRL HRLLGNRWSL IAGRLPGRTD NEIKNYWNSH LCKKVNQKVE KPESSTRHEI 120 IGQNDQNAGD NRAMSENEVE INESGNLDVS LDVNEFFNFS EESFGFDWLN KYLELDQIPE 180 STERSE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-29 | 1 | 105 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN44088.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 3e-88 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003525887.1 | 1e-135 | transcription factor MYB114 | ||||
Refseq | XP_028231799.1 | 1e-135 | transcription factor MYB114-like | ||||
Swissprot | P10290 | 4e-49 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A368UI80 | 1e-134 | A0A368UI80_SOYBN; Uncharacterized protein | ||||
TrEMBL | A0A445KJV3 | 1e-134 | A0A445KJV3_GLYSO; Anthocyanin regulatory C1 protein | ||||
STRING | GLYMA05G04900.1 | 1e-135 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 4e-51 | myb domain protein 66 |