![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN42077.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 101aa MW: 11936 Da PI: 7.505 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 85.1 | 9.8e-27 | 11 | 69 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y+++ed+ ++e+isw e+gn+fvv+++ +fak++LpkyFkh+nf+SFvRQLn+Y KHN42077.1 11 FLTKTYQLVEDPGTDEVISWGESGNTFVVWKHADFAKDLLPKYFKHNNFSSFVRQLNTY 69 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.6E-28 | 3 | 69 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 8.9E-27 | 7 | 94 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 9.11E-24 | 8 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 1.0E-16 | 11 | 34 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 2.8E-22 | 11 | 69 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.0E-16 | 49 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.0E-16 | 62 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MLQQRSVPAP FLTKTYQLVE DPGTDEVISW GESGNTFVVW KHADFAKDLL PKYFKHNNFS 60 SFVRQLNTYV CFICCPFLIL LLSYLHDLVD FHRFMLFILL R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ldu_A | 1e-20 | 1 | 69 | 11 | 78 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN42077.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JN896304 | 4e-95 | JN896304.1 Glycine max heat shock transcription factor HSFB1 mRNA, complete cds. | |||
GenBank | Z46953 | 4e-95 | Z46953.1 G.max mRNA for heat shock transcription factor 34. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001340381.1 | 2e-44 | heat stress transcription factor 25 | ||||
Refseq | XP_028186257.1 | 2e-44 | heat shock factor protein HSF24-like | ||||
Swissprot | Q652B0 | 2e-35 | HFB2C_ORYSJ; Heat stress transcription factor B-2c | ||||
Swissprot | Q6Z9C8 | 1e-35 | HFB2B_ORYSJ; Heat stress transcription factor B-2b | ||||
TrEMBL | A0A445HXF7 | 4e-43 | A0A445HXF7_GLYSO; Heat shock factor protein HSF24 | ||||
TrEMBL | A0A445M509 | 5e-43 | A0A445M509_GLYSO; Heat shock factor protein HSF24 isoform B | ||||
TrEMBL | I1LHE9 | 4e-43 | I1LHE9_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA11G06010.1 | 6e-44 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1592 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11660.1 | 4e-37 | HSF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|