![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN34342.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 188aa MW: 20577.1 Da PI: 7.4047 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 144.5 | 3.1e-45 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++++ KHN34342.1 10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKELDAANA 108 7*********************************************************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.852 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.3E-44 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
GO:0004088 | Molecular Function | carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP 60 HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELDAANADL LRYSYTDITP 120 TSLSVPPGLA SFHQVPQRQF SARFGNEASG FYRHQSAATA FSFPYALPWT DTSSEDISEG 180 AGAGGGNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-68 | 3 | 125 | 4 | 128 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-68 | 3 | 125 | 4 | 128 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00581 | DAP | Transfer from AT5G63090 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN34342.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT098178 | 0.0 | BT098178.1 Soybean clone JCVI-FLGm-12K19 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003525551.2 | 1e-139 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_006579579.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_006579580.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_006579581.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_028231547.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_028231548.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 6e-74 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A0R0JQP9 | 1e-137 | A0A0R0JQP9_SOYBN; Uncharacterized protein | ||||
TrEMBL | A0A445KIZ8 | 1e-137 | A0A445KIZ8_GLYSO; Protein LATERAL ORGAN BOUNDARIES isoform A | ||||
TrEMBL | K7KMS9 | 1e-137 | K7KMS9_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA05G02530.4 | 1e-138 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1091 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 3e-76 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|