PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN28504.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 189aa MW: 21956.4 Da PI: 4.5356 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 116 | 3.9e-36 | 8 | 127 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 lppGfrF Ptdeelvv++L++k++ +++ +vi+++++y ++Pw+L+ ++ ae k+wy++s+r +nr+t +gyW g +++v+s+ +++ KHN28504.1 8 LPPGFRFYPTDEELVVHFLQRKANLLPCHP-DVIPDLELYPYDPWELHGRALAEGKQWYYYSRRT--------QNRVTGNGYWMPMGMEEPVVSSsSNK 97 79*************************999.99**************97777889*******984........58******************986777 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 vg+kk vf+ g+ap+g+ t+W+m+eyrl KHN28504.1 98 RVGMKKYYVFHLGEAPDGNTTNWIMQEYRL 127 8***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.49E-48 | 5 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 44.983 | 8 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.0E-22 | 9 | 127 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MGDNNVNLPP GFRFYPTDEE LVVHFLQRKA NLLPCHPDVI PDLELYPYDP WELHGRALAE 60 GKQWYYYSRR TQNRVTGNGY WMPMGMEEPV VSSSSNKRVG MKKYYVFHLG EAPDGNTTNW 120 IMQEYRLLDS DSSSRSSKRR SQPKPDHNKW VICQVYEQDN DDDGDGTELS CLDEVFLSLD 180 DLEEISLPN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-40 | 4 | 160 | 13 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-40 | 4 | 160 | 13 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-40 | 4 | 160 | 13 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-40 | 4 | 160 | 13 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-40 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swm_B | 4e-40 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swm_C | 4e-40 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swm_D | 4e-40 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swp_A | 4e-40 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swp_B | 4e-40 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swp_C | 4e-40 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swp_D | 4e-40 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
4dul_A | 4e-40 | 4 | 160 | 13 | 167 | NAC domain-containing protein 19 |
4dul_B | 4e-40 | 4 | 160 | 13 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN28504.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU661918 | 1e-120 | EU661918.1 Glycine max NAC domain protein (NAC18) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003524754.1 | 1e-140 | NAC domain-containing protein 104 | ||||
Refseq | XP_028232345.1 | 1e-140 | NAC domain-containing protein 104-like | ||||
Swissprot | Q8GWK6 | 3e-84 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A0B2R8L1 | 1e-139 | A0A0B2R8L1_GLYSO; NAC domain-containing protein 104 | ||||
TrEMBL | I1K2S0 | 1e-139 | I1K2S0_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA05G24910.1 | 1e-140 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1736 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 8e-84 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|