![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN18311.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 142aa MW: 16600.9 Da PI: 10.4625 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.6 | 3.4e-14 | 31 | 76 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W+teE ++l+++v+++ + +W++I+r++ gR+ k c +rw + KHN18311.1 31 KGPWSTEEVQILIRLVERYDPQNWSLISRYIK-GRSNKLCLLRWCNQ 76 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 42.8 | 1.2e-13 | 85 | 127 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +++++E + ++ a +++ ++ W+tIar ++ gRt + +k++w++ KHN18311.1 85 PFSAQENDTIIVAYAKYDNR-WATIARLLP-GRTNNAIKNHWNSI 127 79******************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.431 | 26 | 81 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.74E-28 | 28 | 124 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.0E-11 | 30 | 79 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.4E-19 | 32 | 84 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.41E-9 | 33 | 75 | No hit | No description |
Pfam | PF13921 | 1.1E-13 | 34 | 91 | No hit | No description |
SMART | SM00717 | 7.6E-11 | 82 | 130 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 13.573 | 83 | 132 | IPR017930 | Myb domain |
CDD | cd00167 | 2.02E-7 | 85 | 128 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.9E-20 | 85 | 131 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MEVTNKSSSF TFSSFDCCSS ESNPNKPSRI KGPWSTEEVQ ILIRLVERYD PQNWSLISRY 60 IKGRSNKLCL LRWCNQLSPP MEHRPFSAQE NDTIIVAYAK YDNRWATIAR LLPGRTNNAI 120 KNHWNSILKR RAKGIQRTDK WP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 6e-34 | 27 | 132 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 6e-34 | 27 | 132 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN18311.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT031192 | 1e-134 | KT031192.1 Glycine max clone HN_CCL_38 MYB/HD-like transcription factor (Glyma06g04010.1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028181328.1 | 1e-102 | transcription factor MYB77-like | ||||
Swissprot | Q9SN12 | 9e-47 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A0B2Q9Q4 | 1e-101 | A0A0B2Q9Q4_GLYSO; Transcription factor MYB44 | ||||
TrEMBL | K7LCR2 | 1e-101 | K7LCR2_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA09G12164.1 | 1e-102 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5074 | 32 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 4e-49 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|