![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN17489.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 171aa MW: 18483.1 Da PI: 9.7686 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100 | 1.5e-31 | 33 | 90 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ ++ ++v+itY+g H+h+ KHN17489.1 33 ADGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVDNSDAVIITYKGVHDHD 90 6********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.2E-32 | 17 | 92 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.846 | 27 | 92 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.11E-28 | 28 | 92 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.6E-35 | 32 | 91 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.8E-24 | 34 | 89 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MKKGDLTDMD SPVKPGKKSK FVVHAAGDVG ISADGYRWRK YGQKMVKGNP HPRNYYRCTS 60 AGCPVRKHIE TAVDNSDAVI ITYKGVHDHD MPVPKKRHGP PSAPLVAAAA PASLNSLQAK 120 KSDSPQNKKI STQWSVDTEG ELTGEALELG GEKAMESART LLSIGFEIKP C |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ayd_A | 4e-28 | 19 | 92 | 1 | 74 | WRKY transcription factor 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN17489.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT031228 | 0.0 | KT031228.1 Glycine max clone HN_CCL_111 WRKY transcription factor (Glyma02g36510.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028210745.1 | 1e-123 | probable WRKY transcription factor 32 isoform X1 | ||||
Swissprot | P59583 | 2e-82 | WRK32_ARATH; Probable WRKY transcription factor 32 | ||||
TrEMBL | A0A445G397 | 1e-122 | A0A445G397_GLYSO; Putative WRKY transcription factor 32 isoform A | ||||
TrEMBL | A0A445G3B2 | 1e-122 | A0A445G3B2_GLYSO; Putative WRKY transcription factor 32 isoform B | ||||
STRING | GLYMA17G08170.1 | 1e-122 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5198 | 34 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G30935.1 | 1e-65 | WRKY DNA-binding protein 32 |
Publications ? help Back to Top | |||
---|---|---|---|
|