![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN16115.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 141aa MW: 16011.1 Da PI: 8.073 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 160.4 | 2.7e-50 | 4 | 99 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 eqdr lPianvsrimk++lP akisk+ k+++qecv+efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y+e++ yl+kyr++e+ek KHN16115.1 4 DEQDRALPIANVSRIMKQILPPSAKISKEGKQVMQECVTEFISFVTGEASDKCHKENRKTVNGDDICWALSSLGFDNYAEAIGRYLHKYRQAEREK 99 59*******************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.7E-48 | 3 | 109 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.86E-37 | 6 | 112 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-25 | 9 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-18 | 37 | 55 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 40 | 56 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-18 | 56 | 74 | No hit | No description |
PRINTS | PR00615 | 1.4E-18 | 75 | 93 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MDQDEQDRAL PIANVSRIMK QILPPSAKIS KEGKQVMQEC VTEFISFVTG EASDKCHKEN 60 RKTVNGDDIC WALSSLGFDN YAEAIGRYLH KYRQAEREKI NHDKKYENPH INRAPPPPLL 120 LSRVTRDKVE NPPPSPPNQS G |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-42 | 5 | 94 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-42 | 5 | 94 | 3 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00133 | DAP | Transfer from AT1G09030 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN16115.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC235914 | 0.0 | AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003535337.1 | 1e-103 | nuclear transcription factor Y subunit B-4 | ||||
Refseq | XP_028183985.1 | 1e-103 | nuclear transcription factor Y subunit B-4-like | ||||
Refseq | XP_028183986.1 | 1e-103 | nuclear transcription factor Y subunit B-4-like | ||||
Refseq | XP_028183987.1 | 1e-103 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 2e-54 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A445IMX3 | 1e-101 | A0A445IMX3_GLYSO; Nuclear transcription factor Y subunit B-4 isoform A | ||||
TrEMBL | K7LJK2 | 1e-101 | K7LJK2_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA10G29440.2 | 1e-102 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 8e-57 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|