![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN14878.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 149aa MW: 17135.2 Da PI: 7.184 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 73.5 | 2.9e-23 | 29 | 82 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprl W +eLH++Fve v q+ G +kA Pk+i+e+m+++gLt+e+v+SHLQk+R KHN14878.1 29 KPRLMWRQELHQQFVEDVMQI-GLDKAKPKRIVEAMNIPGLTREQVASHLQKHRH 82 79*******************.*******************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.9E-24 | 27 | 82 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 7.88E-16 | 27 | 82 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.2E-20 | 29 | 82 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
ARGQEKIGTN FKESDSDELD DSFAPPTKKP RLMWRQELHQ QFVEDVMQIG LDKAKPKRIV 60 EAMNIPGLTR EQVASHLQKH RHELLLNTSK GVTLQQNEKT LSNNIESKRR AGAYGRFDLT 120 AFGDTSHLSY AALHPEERME DQWPYYSLA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5lxu_A | 6e-15 | 29 | 81 | 1 | 53 | Transcription factor LUX |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN14878.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014627221.1 | 5e-83 | two-component response regulator ARR14-like | ||||
Refseq | XP_028217064.1 | 5e-83 | two-component response regulator ARR14-like | ||||
TrEMBL | A0A0B2Q4F1 | 1e-108 | A0A0B2Q4F1_GLYSO; Two-component response regulator ARR1 (Fragment) | ||||
STRING | GLYMA19G07198.1 | 6e-52 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF36671 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G16857.1 | 1e-22 | response regulator 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|