PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00769.1
Organism
Glycine soja
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 67aa    MW: 7630.72 Da    PI: 4.9899
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00769.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM58.62.2e-182065248
         NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                +pGfrFhPtdeelv++yLk+k+ gk+l+l +vi+e+d+yk++P+dLp
  KHN00769.1 20 MPGFRFHPTDEELVMYYLKRKICGKRLKL-DVIHETDVYKWDPEDLP 65
                69***************************.9***************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-191466IPR003441NAC domain
PROSITE profilePS5100519.6681967IPR003441NAC domain
PfamPF023652.2E-82144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MGEASGAGSA DCFSQMMSSM PGFRFHPTDE ELVMYYLKRK ICGKRLKLDV IHETDVYKWD  60
PEDLPGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-1421651761Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13746KRKICGKRLK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN00769.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0118131e-100AP011813.1 Glycine max DNA, BAC clone: MiB319A04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556180.15e-42NAC domain-containing protein 17
RefseqXP_006606193.15e-42NAC domain-containing protein 17
RefseqXP_028220619.15e-42NAC domain-containing protein 17-like
SwissprotQ9XIC52e-21NAC17_ARATH; NAC domain-containing protein 17
TrEMBLA0A445F6971e-40A0A445F697_GLYSO; NAC domain-containing protein 17 isoform B
TrEMBLA0A445F6C51e-40A0A445F6C5_GLYSO; NAC domain-containing protein 17 isoform A
TrEMBLI1NH701e-40I1NH70_SOYBN; Uncharacterized protein
STRINGGLYMA20G31210.12e-41(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-23NAC domain containing protein 17
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Van Aken O, et al.
    Mitochondrial and Chloroplast Stress Responses Are Modulated in Distinct Touch and Chemical Inhibition Phases.
    Plant Physiol., 2016. 171(3): p. 2150-65
    [PMID:27208304]
  4. Van Aken O,Ford E,Lister R,Huang S,Millar AH
    Retrograde signalling caused by heritable mitochondrial dysfunction is partially mediated by ANAC017 and improves plant performance.
    Plant J., 2016. 88(4): p. 542-558
    [PMID:27425258]
  5. Hu Z, et al.
    Mitochondrial Defects Confer Tolerance against Cellulose Deficiency.
    Plant Cell, 2016. 28(9): p. 2276-2290
    [PMID:27543091]
  6. Chi YH, et al.
    The membrane-tethered NAC transcription factor, AtNTL7, contributes to ER-stress resistance in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2017. 488(4): p. 641-647
    [PMID:28088515]
  7. Van Aken O,Pogson BJ
    Convergence of mitochondrial and chloroplastic ANAC017/PAP-dependent retrograde signalling pathways and suppression of programmed cell death.
    Cell Death Differ., 2017. 24(6): p. 955-960
    [PMID:28498364]
  8. Cheng P, et al.
    The ERA-Related GTPase AtERG2 Associated with Mitochondria 18S RNA Is Essential for Early Embryo Development in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 182
    [PMID:29497438]