PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis

Family

MYB_related

Protein Properties

Length: 123aa MW: 14633.7 Da PI: 5.2567

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KFK43105.1	genome	MPIPBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	36.5	1.1e-11	14	58	2	47
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g W Ede+l av ++G ++W++I++ + ++++kqc +rw+ + KFK43105.1 14 GVWKNTEDEILNVAVMKYGLNQWDRISSLLV-RKSPKQCEDRWYEW 58 68***************************.*********987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	2.42E-12	8	58	IPR009057	Homeodomain-like
PROSITE profile	PS51294	10.537	8	63	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-12	10	58	IPR009057	Homeodomain-like
SMART	SM00717	6.2E-10	12	61	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-10	14	58	IPR001005	SANT/Myb domain
CDD	cd00167	2.90E-9	16	58	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.8E-7	60	100	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.73E-9	61	104	IPR009057	Homeodomain-like
CDD	cd11659	2.80E-20	61	102	No hit	No description
Pfam	PF13921	1.8E-8	62	105	No hit	No description
SMART	SM00717	0.031	62	105	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	6.829	62	103	IPR017877	Myb-like domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 123 aa Download sequence Send to blast
MTMTMTMTIK MNQGVWKNTE DEILNVAVMK YGLNQWDRIS SLLVRKSPKQ CEDRWYEWQA 60 EWSREEDEKL MHIAKLMPNQ WRSIALIVGF SPTQCFERYE FLRSKENYQA ADDPNPESKA 120 CTS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
5xjc_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
5yzg_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
5z56_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
5z57_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
5z58_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
6ff4_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
6ff7_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
6icz_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
6id0_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
6id1_L	1e-40	9	121	4	137	Cell division cycle 5-like protein
6qdv_O	1e-40	9	121	4	137	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KFK43105.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC254583	4e-34	AC254583.1 Capsella rubella clone JGIBSIA-25G5, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_005851759.1	1e-47	hypothetical protein CHLNCDRAFT_33512, partial
Refseq	XP_010528754.1	3e-46	PREDICTED: cell division cycle 5-like protein
Swissprot	P92948	2e-46	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A087HLV3	8e-88	A0A087HLV3_ARAAL; Uncharacterized protein
STRING	A0A087HLV3	1e-88	(Arabis alpina)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	6e-48	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]