PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK36518.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 163aa MW: 19010.2 Da PI: 6.2737 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 42.3 | 1.6e-13 | 71 | 121 | 4 | 54 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 ++++r+k++NRe+ArrsR RK+ +++eL v L +eN++L +l++ + KFK36518.1 71 DRKQRKKISNRESARRSRMRKQRQLDELWSQVMWLRNENHQLLHKLNRVLE 121 789******************************************998755 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.4E-12 | 65 | 132 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.484 | 70 | 133 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.4E-10 | 70 | 122 | No hit | No description |
Pfam | PF00170 | 5.8E-11 | 71 | 122 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.53E-11 | 72 | 121 | No hit | No description |
CDD | cd14702 | 7.90E-17 | 73 | 121 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 75 | 90 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MQPSTDIFSL HGSAPSYFSP FPISSPFRVN GITPNTFYSF QTGVNNPQSM TLSSNSTSDE 60 AEENQEDIVN DRKQRKKISN RESARRSRMR KQRQLDELWS QVMWLRNENH QLLHKLNRVL 120 ESQEKVVEEN AQLKEEAVEL KQMISDMQLQ NQSPFSCFRD DIV |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 84 | 91 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00533 | DAP | Transfer from AT5G38800 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK36518.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006405699.2 | 5e-91 | LOW QUALITY PROTEIN: basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 6e-85 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A087H316 | 1e-117 | A0A087H316_ARAAL; Uncharacterized protein | ||||
STRING | A0A087H316 | 1e-117 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3112 | 26 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G38800.1 | 2e-78 | basic leucine-zipper 43 |
Publications ? help Back to Top | |||
---|---|---|---|
|