PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis

Family

MYB

Protein Properties

Length: 238aa MW: 27161.8 Da PI: 7.9354

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KFK33687.1	genome	MPIPBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.1	2e-18	15	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd llv++v+ +G++ W+ Ia+++ gR +kqc++rw+++l KFK33687.1 15 KGQWTSEEDRLLVQLVESHGTKKWSQIAKMLE-GRVGKQCRERWHNHL 61 799***************************.***********97 PP
2	Myb_DNA-binding	52.8	9.1e-17	67	109	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++ W++eEd +l++a+k+ G++ W+ ar+++ gRt++ +k++w+ KFK33687.1 67 KDVWSEEEDRILIEAHKEIGNK-WAEMARKLP-GRTENTIKNHWN 109 578*****************.*****.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	30.051	10	65	IPR017930	Myb domain
SuperFamily	SSF46689	7.7E-32	12	108	IPR009057	Homeodomain-like
SMART	SM00717	1.4E-16	14	63	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-28	16	68	IPR009057	Homeodomain-like
Pfam	PF13921	1.6E-17	18	72	No hit	No description
CDD	cd00167	9.70E-15	18	61	No hit	No description
PROSITE profile	PS51294	19.581	66	116	IPR017930	Myb domain
SMART	SM00717	2.3E-15	66	114	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-21	69	114	IPR009057	Homeodomain-like
CDD	cd00167	3.42E-11	70	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010439	Biological Process	regulation of glucosinolate biosynthetic process
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:1904095	Biological Process	negative regulation of endosperm development
GO:2000692	Biological Process	negative regulation of seed maturation
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 238 aa Download sequence Send to blast
MRRGCKSIKK ANIIKGQWTS EEDRLLVQLV ESHGTKKWSQ IAKMLEGRVG KQCRERWHNH 60 LRPDIKKDVW SEEEDRILIE AHKEIGNKWA EMARKLPGRT ENTIKNHWNA TKRRQHSRRA 120 KGKDEISLAL GSNTLQNYIR SVTYNDDTLL TMSSTNANPN DGPENMREEG TQTLPLELMT 180 TTCESGSSST CDSVSVSRSG VTTEIDEPMT DSWMVMHGCD EVMLKEIALL EMIAHGRL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	1e-46	13	115	2	104	MYB PROTO-ONCOGENE PROTEIN
1mse_C	1e-46	13	115	2	104	C-Myb DNA-Binding Domain
1msf_C	1e-46	13	115	2	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269\|PubMed:18695688, ECO:0000269\|PubMed:19066902, ECO:0000269\|PubMed:25194028, ECO:0000269\|PubMed:27681170}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00385	DAP	Transfer from AT3G27785	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KFK33687.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by LEC2. {ECO:0000269\|PubMed:25194028}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010425555.1	1e-120	PREDICTED: transcription factor MYB98-like
Swissprot	Q9LVW4	1e-119	MY118_ARATH; Transcription factor MYB118
TrEMBL	A0A087GUY5	1e-175	A0A087GUY5_ARAAL; Uncharacterized protein
STRING	A0A087GUY5	1e-176	(Arabis alpina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6052	26	43

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27785.1	1e-119	myb domain protein 118

Publications ? help Back to Top
Troncoso-Ponce MA, et al. Transcriptional Activation of Two Delta-9 Palmitoyl-ACP Desaturase Genes by MYB115 and MYB118 Is Critical for Biosynthesis of Omega-7 Monounsaturated Fatty Acids in the Endosperm of Arabidopsis Seeds. Plant Cell, 2016. 28(10): p. 2666-2682 [PMID:27681170] Ettaki H, et al. Overexpression of MYB115, AAD2, or AAD3 in Arabidopsis thaliana seeds yields contrasting omega-7 contents. PLoS ONE, 2018. 13(1): p. e0192156 [PMID:29381741]