![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK22006.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 103aa MW: 12443.9 Da PI: 7.9553 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.3 | 3.6e-08 | 36 | 74 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +T++E++l+ + +++ G + W++Ia ++ gR +k++ +w KFK22006.1 36 MTEQEEDLIFRMHRLVGDR-WDLIAGRVA-GREAKEIERYW 74 7****************99.*********.*********** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 5.7E-6 | 32 | 80 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.62E-6 | 35 | 74 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-10 | 36 | 75 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-7 | 36 | 75 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.72E-7 | 37 | 75 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MDNTNRLHDR RNRNHTKITL RESEEVSSIK WEFINMTEQE EDLIFRMHRL VGDRWDLIAG 60 RVAGREAKEI ERYWIMKNSD YFSNTRLQLH SLNTSPHSSI SHF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK22006.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ108777 | 7e-57 | DQ108777.1 Arabidopsis thaliana clone 22671 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006295305.1 | 1e-43 | MYB-like transcription factor TCL2 isoform X1 | ||||
Swissprot | B3H4X8 | 5e-43 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
TrEMBL | A0A087FWK4 | 1e-69 | A0A087FWK4_ARAAL; Uncharacterized protein | ||||
STRING | A0A087FWK4 | 2e-70 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30424.1 | 2e-45 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|