![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KDD73886.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 66aa MW: 7348.31 Da PI: 5.631 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 83.4 | 2.8e-26 | 13 | 61 | 2 | 50 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtsea 50 r qd+flPian+srimkk lP+n+ki+kdaket+qecvsefisf+tse KDD73886.1 13 RRQDHFLPIANISRIMKKYLPGNSKIAKDAKETMQECVSEFISFITSEC 61 789********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.7E-24 | 9 | 60 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.79E-19 | 10 | 64 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-17 | 18 | 61 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
MGDDCGDEGQ NGRRQDHFLP IANISRIMKK YLPGNSKIAK DAKETMQECV SEFISFITSE 60 CVIHGS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-20 | 13 | 60 | 2 | 49 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-20 | 13 | 60 | 2 | 49 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011396982.1 | 5e-26 | Nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q67XJ2 | 9e-23 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
Swissprot | Q9SLG0 | 5e-23 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A0A059LI72 | 3e-42 | A0A059LI72_9CHLO; Uncharacterized protein | ||||
STRING | A0A087SEE2 | 2e-25 | (Auxenochlorella protothecoides) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2023 | 16 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.6 | 1e-25 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|