![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KDD72353.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 250aa MW: 28687.6 Da PI: 9.9201 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.2 | 1.9e-13 | 8 | 52 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 W Ede+l+ av ++G ++W++I++ + ++++kqck rw+ +l KDD72353.1 8 IWKNTEDEILKAAVMKYGLNQWSRISSLLV-RKSAKQCKARWYEWL 52 5999**************************.************986 PP | |||||||
2 | Myb_DNA-binding | 34.1 | 6.5e-11 | 59 | 101 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 WT eEde+l+++ k++++ W+tIa +g Rt+ qc +r+ + KDD72353.1 59 TEWTREEDEKLLHLAKLMPTQ-WRTIAPVVG--RTPTQCLERYERL 101 68*****************99.********8..*********9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.206 | 1 | 56 | IPR017930 | Myb domain |
SMART | SM00717 | 8.7E-14 | 5 | 54 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-19 | 8 | 60 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.32E-11 | 9 | 52 | No hit | No description |
Pfam | PF13921 | 8.4E-14 | 9 | 69 | No hit | No description |
SuperFamily | SSF46689 | 7.19E-21 | 32 | 104 | IPR009057 | Homeodomain-like |
CDD | cd11659 | 1.34E-30 | 54 | 106 | No hit | No description |
PROSITE profile | PS51294 | 15.911 | 57 | 106 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-12 | 57 | 104 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-14 | 61 | 103 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009870 | Biological Process | defense response signaling pathway, resistance gene-dependent | ||||
GO:0010204 | Biological Process | defense response signaling pathway, resistance gene-independent | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0009507 | Cellular Component | chloroplast | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MFLIKGGIWK NTEDEILKAA VMKYGLNQWS RISSLLVRKS AKQCKARWYE WLDPAIKKTE 60 WTREEDEKLL HLAKLMPTQW RTIAPVVGRT PTQCLERYER LLDAATGEDG GAGSSRDDPR 120 RLRPGEIDPN PESKPARPDP IDMDEDEKEM LSEARARLAN TKGKKAKRKA RERALDEARR 180 LATLQKKREL KAAGIETRDR GPRRGAIDYG TEVPFERRPA AGFHDVEEER ERAQSLRAEF 240 RPATVEQLEG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5mqf_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
5xjc_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
5yzg_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
5z56_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
5z57_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
5z58_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
6ff4_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
6ff7_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
6icz_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
6id0_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
6id1_L | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
6qdv_O | 1e-115 | 2 | 250 | 4 | 249 | Cell division cycle 5-like protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00028 | SELEX | Transfer from AT1G09770 | Download |
![]() |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005648666.1 | 1e-136 | hypothetical protein COCSUDRAFT_65754 | ||||
Swissprot | P92948 | 1e-122 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
TrEMBL | A0A059LDG0 | 1e-179 | A0A059LDG0_9CHLO; Uncharacterized protein (Fragment) | ||||
STRING | XP_005648666.1 | 1e-135 | (Coccomyxa subellipsoidea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP1040 | 16 | 17 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09770.1 | 1e-117 | cell division cycle 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|