![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S28332.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 113aa MW: 13165.4 Da PI: 10.527 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.6 | 2.2e-16 | 25 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l ++ G g+W+ Iar g+ R++k+c++rw +yl Jcr4S28332.20 25 KGLWSPEEDEKLMKYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYL 72 678*****************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-23 | 20 | 75 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.849 | 20 | 76 | IPR017930 | Myb domain |
SMART | SM00717 | 4.7E-12 | 24 | 74 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.6E-15 | 25 | 72 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.94E-22 | 27 | 100 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.27E-9 | 28 | 72 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.0E-9 | 76 | 100 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MRKPDLMGKE RVNSNNNNIK AKLRKGLWSP EEDEKLMKYM LTNGQGCWSD IARNAGLLRC 60 GKSCRLRWIN YLRPDLKRGA FSPQEEELII HLHSILGNRF FSPSSLLNKF LLF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 6e-16 | 22 | 107 | 24 | 108 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1 and its close homologs, including NAC043/NST1, NAC066/NST2, NAC101/VND6 and NAC030/VND7. Is required for functional expression of a number of secondary wall-associated transcription factors and secondary wall biosynthetic genes involved in cellulose, xylan and lignin synthesis. Functions redundantly with MYB46 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). {ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM034661 | 0.0 | KM034661.1 Jatropha curcas clone JcMYB041 MYB family protein gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012065560.1 | 2e-66 | transcription factor MYB86 | ||||
Swissprot | Q9C6U1 | 6e-52 | MYB83_ARATH; Transcription factor MYB83 | ||||
TrEMBL | A0A067LFZ9 | 5e-65 | A0A067LFZ9_JATCU; MYB family protein | ||||
STRING | cassava4.1_028035m | 8e-58 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G08500.1 | 2e-54 | myb domain protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|