PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

bZIP

Protein Properties

Length: 67aa MW: 7820.91 Da PI: 6.8189

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S14510.10	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	28.6	3.1e-09	3	41	17	55
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 A+rsR RK+++i+eLe+ v++L+ae ++ e+e l+++ Jcr4S14510.10 3 AQRSRVRKLQYIAELERNVQALQAEGSEVSAEVEFLNQQ 41 89*************************999999999887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd14703	1.45E-10	1	42	No hit	No description
SuperFamily	SSF57959	1.8E-7	3	45	No hit	No description
Gene3D	G3DSA:1.20.5.170	5.3E-10	3	45	No hit	No description

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
QFAQRSRVRK LQYIAELERN VQALQAEGSE VSAEVEFLNQ QNLILSMENK ALKQRLESIA 60 QEQLIKY

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269\|PubMed:17719007, ECO:0000269\|PubMed:19449183}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012071280.1	5e-37	uncharacterized protein At4g06598
Refseq	XP_020534676.1	5e-37	uncharacterized protein At4g06598
Swissprot	F4IN23	3e-18	BZP34_ARATH; Basic leucine zipper 34
TrEMBL	A0A067KV23	1e-35	A0A067KV23_JATCU; Uncharacterized protein
TrEMBL	A4ZGT8	1e-35	A4ZGT8_SOYBN; Transcription factor bZIP63 (Fragment)
STRING	AET04427	1e-35	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5123	26	37

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G58110.2	8e-35	bZIP family protein

Link Out ? help Back to Top
Entrez Gene	105633319

Publications ? help Back to Top
Jiang J,Zhang Z,Cao J Pollen wall development: the associated enzymes and metabolic pathways. Plant Biol (Stuttg), 2013. 15(2): p. 249-63 [PMID:23252839] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]