![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S13195.30 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 10465.9 Da PI: 7.3649 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 23.3 | 1.5e-07 | 29 | 68 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++++E++l+++ k+ G + W +Ia +++ gR ++++ +w Jcr4S13195.30 29 MSEQEEDLIYRMYKLVGDR-WGLIAGRIP-GRKAEEIERFWI 68 79***************99.*********.*********995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 5.2E-5 | 25 | 73 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.06E-5 | 28 | 67 | No hit | No description |
Pfam | PF00249 | 8.4E-7 | 29 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-9 | 30 | 68 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.69E-7 | 30 | 68 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MDRRRRKQPK TATCLSEEVS SIEWEFINMS EQEEDLIYRM YKLVGDRWGL IAGRIPGRKA 60 EEIERFWIMR HGEVFASRRE ELKSSES |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012083240.1 | 3e-57 | transcription factor TRY | ||||
Refseq | XP_012083241.1 | 3e-57 | transcription factor TRY | ||||
Swissprot | Q8GV05 | 6e-39 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A314YUZ8 | 7e-48 | A0A314YUZ8_PRUYE; Transcription factor CPC | ||||
STRING | XP_008233205.1 | 3e-48 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3583 | 27 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 2e-41 | MYB_related family protein |