![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S10824.20 | ||||||||
Common Name | JCGZ_17894 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 161aa MW: 18768.8 Da PI: 4.87 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.8 | 2.2e-17 | 10 | 53 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+ E++++++++ +lG++ W++Ia++++ gRt++++k++w++ Jcr4S10824.20 10 RGALTEAEEDQIIELHSRLGNR-WSKIAAHFP-GRTDNEIKNHWNT 53 7899******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 3.59E-16 | 1 | 65 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.1E-25 | 1 | 60 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 27.354 | 5 | 59 | IPR017930 | Myb domain |
SMART | SM00717 | 1.5E-15 | 9 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.0E-16 | 10 | 53 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.57E-11 | 14 | 53 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MNYLRPDLKR GALTEAEEDQ IIELHSRLGN RWSKIAAHFP GRTDNEIKNH WNTRIKKKLK 60 ILGIDPQTHK RIDTEEAETS KEESKVKDYQ IESESLRKEF DAGSVLNSCT DKSESFCSRI 120 EESVIKEESQ QNWIDNVDSL LSWDGFNNLE EIFPFDSHQL C |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-15 | 2 | 59 | 51 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM017553 | 0.0 | KM017553.1 Jatropha curcas isolate A MYB117 (MYB117) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001292961.1 | 1e-113 | myb-related protein 315 | ||||
Swissprot | P81394 | 8e-41 | MYB15_ANTMA; Myb-related protein 315 | ||||
TrEMBL | A0A067JS30 | 1e-112 | A0A067JS30_JATCU; MYB family protein | ||||
STRING | cassava4.1_021041m | 4e-52 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6625 | 31 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14340.1 | 4e-37 | myb domain protein 40 |
Publications ? help Back to Top | |||
---|---|---|---|
|