![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S09941.10 | ||||||||
Common Name | JCGZ_26777, LOC105630130 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 152aa MW: 17024.2 Da PI: 9.7599 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 40.3 | 7e-13 | 32 | 85 | 5 | 58 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 ++ +r+++NRe+ArrsR RK++ ++ L v++L +e ++L ++ +++ + Jcr4S09941.10 32 RKRKRMISNRESARRSRMRKQKHLDDLIAQVAQLRKESHQLLTSINITTQHFLN 85 6789*************************************9999877776655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 5.5E-18 | 28 | 92 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.128 | 30 | 93 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.9E-11 | 30 | 77 | No hit | No description |
SuperFamily | SSF57959 | 1.85E-12 | 32 | 84 | No hit | No description |
Pfam | PF00170 | 4.2E-10 | 32 | 77 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 8.48E-19 | 33 | 83 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 35 | 50 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009845 | Biological Process | seed germination | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MASSSGTTTS SGSTLMQNSG SEEDLRALMD QRKRKRMISN RESARRSRMR KQKHLDDLIA 60 QVAQLRKESH QLLTSINITT QHFLNIEADN SILRAQVGAL SHRLQSLNEI IAFLSANNGF 120 LAEEPAADSF LNPLNMSYLN QPIMASADIF QY |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 31 | 52 | RKRKRMISNRESARRSRMRKQK |
2 | 44 | 51 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00239 | DAP | Transfer from AT1G75390 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012067226.1 | 1e-106 | bZIP transcription factor 11 isoform X1 | ||||
Swissprot | C0Z2L5 | 3e-54 | BZP44_ARATH; bZIP transcription factor 44 | ||||
TrEMBL | A0A067LCG7 | 1e-105 | A0A067LCG7_JATCU; Uncharacterized protein | ||||
STRING | cassava4.1_028474m | 5e-78 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF613 | 34 | 147 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75390.1 | 1e-53 | basic leucine-zipper 44 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105630130 |
Publications ? help Back to Top | |||
---|---|---|---|
|