PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

SBP

Protein Properties

Length: 183aa MW: 20081.3 Da PI: 9.3014

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S05050.30	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	140.4	5e-44	49	123	2	76
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 Cqve+C adls+ak+yhrrhkvCevh+kap+v+v+gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+ Jcr4S05050.30 49 CQVEKCGADLSDAKRYHRRHKVCEVHAKAPAVIVAGLRQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKS 123 *************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	1.8E-37	41	110	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	33.419	46	123	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	3.14E-40	47	123	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	7.7E-34	49	122	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 183 aa Download sequence Send to blast
MEDYDMEEEE GNGGFADDEK KKGVGVVYGK RGTAAAGGGG GGGVSPPSCQ VEKCGADLSD 60 AKRYHRRHKV CEVHAKAPAV IVAGLRQRFC QQCSRFHELS EFDEAKRSCR RRLAGHNERR 120 RKSLSAESNG ESSSLSSSSR SKGAFGAQLK ETQCLRQVEE RPKYQITIPL PGNSDYKRSQ 180 LRS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	3e-39	39	122	1	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:16914499}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305\|PubMed:12202040, ECO:0000305\|PubMed:16914499}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012076538.1	1e-132	squamosa promoter-binding protein 1
Swissprot	Q9S7A9	1e-47	SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBL	A0A067LM63	1e-130	A0A067LM63_JATCU; Uncharacterized protein
STRING	POPTR_0001s40870.1	3e-73	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G53160.2	4e-44	squamosa promoter binding protein-like 4

Link Out ? help Back to Top
Entrez Gene	105637624

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971] Hyun Y, et al. Site-directed mutagenesis in Arabidopsis thaliana using dividing tissue-targeted RGEN of the CRISPR/Cas system to generate heritable null alleles. Planta, 2015. 241(1): p. 271-84 [PMID:25269397] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] Ioannidi E, et al. Trichome patterning control involves TTG1 interaction with SPL transcription factors. Plant Mol. Biol., 2016. 92(6): p. 675-687 [PMID:27631431] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142]