![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S01955.60 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 135aa MW: 14273.1 Da PI: 9.9865 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 77.5 | 2e-24 | 71 | 119 | 1 | 49 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 +CqvegC++dls+ak y++rhkvC +hsk+p+v+v+gleqrfCqqCsr Jcr4S01955.60 71 RCQVEGCKVDLSDAKAYYSRHKVCGMHSKSPKVIVAGLEQRFCQQCSRL 119 6**********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.7E-26 | 64 | 119 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 18.537 | 69 | 135 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 8.37E-24 | 69 | 120 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.3E-19 | 72 | 119 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MGSGSFTESG DSSPSSPPVE CINGLKFGKK IYFENAGTGA GAPVKSTTGS SSSGSGASAR 60 KVHGGQQQPP RCQVEGCKVD LSDAKAYYSR HKVCGMHSKS PKVIVAGLEQ RFCQQCSRLR 120 YKWRGRDVVV ALNVS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 9e-15 | 72 | 119 | 11 | 58 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR157. {ECO:0000305|PubMed:12202040}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012087743.1 | 1e-78 | squamosa promoter-binding-like protein 9 | ||||
Refseq | XP_012087744.1 | 1e-78 | squamosa promoter-binding-like protein 9 | ||||
Swissprot | A2X0Q6 | 1e-25 | SPL3_ORYSI; Squamosa promoter-binding-like protein 3 | ||||
Swissprot | A3A2Z8 | 1e-25 | SPL3_ORYSJ; Squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q9M2Q6 | 1e-25 | SPL15_ARATH; Squamosa promoter-binding-like protein 15 | ||||
TrEMBL | A0A2C9V7F5 | 1e-53 | A0A2C9V7F5_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_032031m | 3e-56 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4208 | 33 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57920.1 | 7e-26 | squamosa promoter binding protein-like 15 |
Publications ? help Back to Top | |||
---|---|---|---|
|