![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S01710.50 | ||||||||
Common Name | JCGZ_06664, LOC105635284 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 147aa MW: 15960.8 Da PI: 5.8182 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 186.9 | 1.5e-58 | 25 | 122 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy+eplkvyl++yre+eg+ Jcr4S01710.50 25 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYREMEGD 120 69*********************************************************************************************9 PP NF-YB 97 kk 98 +k Jcr4S01710.50 121 TK 122 75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.2E-55 | 20 | 130 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.21E-41 | 28 | 130 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.9E-21 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.9E-21 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 1.9E-21 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MAENPTSPAG GSHESGGEQS PHSGVREQDR YLPIANISRI MKKALPANGK IAKDAKDTVQ 60 ECVSEFISFI TSEASDKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKVY LARYREMEGD 120 TKGSARGGDG SAKRDPIGGL PGQNPQF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 3e-48 | 24 | 116 | 1 | 93 | NF-YB |
4awl_B | 3e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KR232272 | 0.0 | KR232272.1 Vernicia fordii nuclear transcription factor Y subunit B-1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012073719.1 | 1e-107 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_020535552.1 | 1e-107 | nuclear transcription factor Y subunit B-1 isoform X3 | ||||
Swissprot | Q8VYK4 | 1e-78 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A067LFV2 | 1e-105 | A0A067LFV2_JATCU; Uncharacterized protein | ||||
STRING | cassava4.1_017552m | 1e-103 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 6e-81 | nuclear factor Y, subunit B8 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105635284 |
Publications ? help Back to Top | |||
---|---|---|---|
|