![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S00706.20 | ||||||||
Common Name | JCGZ_21461, LOC105649564 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 103aa MW: 11440.8 Da PI: 6.2506 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 75.8 | 7.1e-24 | 57 | 103 | 2 | 48 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 Cq+++C+ad+++ak+yhrrhkvCe+h+kap v+v+g++qrfCqqCsr Jcr4S00706.20 57 CQADNCTADMTDAKRYHRRHKVCEFHAKAPLVVVAGIQQRFCQQCSR 103 **********************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.2E-24 | 50 | 103 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 20.179 | 54 | 103 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 8.76E-23 | 55 | 103 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.6E-18 | 57 | 103 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MSTSKAEGKR SLKEMEDEEE EEDEEDCVGG LGFGDDDKKK KNKKGSIGSG SMPPVSCQAD 60 NCTADMTDAK RYHRRHKVCE FHAKAPLVVV AGIQQRFCQQ CSR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 3e-20 | 49 | 103 | 3 | 57 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012091635.1 | 7e-71 | squamosa promoter-binding-like protein 3 isoform X1 | ||||
Refseq | XP_012091636.1 | 6e-71 | squamosa promoter-binding-like protein 3 isoform X2 | ||||
Swissprot | Q38741 | 1e-29 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A067JLV2 | 1e-69 | A0A067JLV2_JATCU; Squamosa promoter-binding-like protein | ||||
STRING | cassava4.1_018710m | 2e-39 | (Manihot esculenta) | ||||
STRING | XP_002509450.1 | 2e-39 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 5e-22 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105649564 |
Publications ? help Back to Top | |||
---|---|---|---|
|