PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S00379.110 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 122aa MW: 13708.9 Da PI: 10.0248 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 59.4 | 4.7e-19 | 31 | 65 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+tt Tp+WR gp g+ktLCnaCG++yrkk++ Jcr4S00379.110 31 CTDCHTTRTPCWRVGPAGPKTLCNACGIRYRKKRR 65 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.044 | 25 | 61 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.9E-13 | 25 | 91 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.62E-13 | 28 | 65 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 6.4E-15 | 29 | 65 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 9.43E-13 | 30 | 65 | No hit | No description |
Pfam | PF00320 | 8.0E-17 | 31 | 65 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
VFLHVLKQDQ ETEETLNNTP SSNCSELKKS CTDCHTTRTP CWRVGPAGPK TLCNACGIRY 60 RKKRRDLFGL DKGGKDKSKK KIAKSSRSKL GMLLQEQWKR KLGEEEQAAF LLMALSYGCV 120 SA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012082847.1 | 9e-62 | GATA transcription factor 15 | ||||
Swissprot | Q9FJ10 | 3e-26 | GAT16_ARATH; GATA transcription factor 16 | ||||
TrEMBL | A0A067K7K2 | 1e-59 | A0A067K7K2_JATCU; Uncharacterized protein | ||||
STRING | cassava4.1_019027m | 7e-54 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1569 | 32 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49300.1 | 8e-26 | GATA transcription factor 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|