![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S00336.60 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | CPP | ||||||||
Protein Properties | Length: 148aa MW: 16645.2 Da PI: 8.7689 | ||||||||
Description | CPP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCR | 51.5 | 2e-16 | 19 | 57 | 3 | 41 |
TCR 3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 +++CnCk+skClk+YCeCfaag++C +C+Ce+C+N+ e Jcr4S00336.60 19 CRRCNCKRSKCLKLYCECFAAGVYCVRSCTCENCFNRPE 57 789*********************************876 PP | |||||||
2 | TCR | 52.8 | 7.7e-17 | 105 | 144 | 1 | 40 |
TCR 1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 ++k+gCnCkkskClkkYCeC++a++ Cs+ C+Ce+C+N+ Jcr4S00336.60 105 RHKRGCNCKKSKCLKKYCECYQAKVGCSSGCRCEGCNNSF 144 589***********************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01114 | 1.4E-15 | 17 | 58 | IPR033467 | Tesmin/TSO1-like CXC domain |
PROSITE profile | PS51634 | 34.63 | 18 | 145 | IPR005172 | CRC domain |
Pfam | PF03638 | 1.7E-12 | 20 | 55 | IPR005172 | CRC domain |
SMART | SM01114 | 5.0E-16 | 105 | 146 | IPR033467 | Tesmin/TSO1-like CXC domain |
Pfam | PF03638 | 1.8E-12 | 107 | 143 | IPR005172 | CRC domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MVCYISRKRT KPVDDSEGCR RCNCKRSKCL KLYCECFAAG VYCVRSCTCE NCFNRPEYED 60 TVLDTRQQIQ ARNPLAFAPK VVIPGMNSPA NLLEDGNWTT PSSARHKRGC NCKKSKCLKK 120 YCECYQAKVG CSSGCRCEGC NNSFGKKT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5fd3_A | 4e-19 | 22 | 142 | 14 | 120 | Protein lin-54 homolog |
5fd3_B | 4e-19 | 22 | 142 | 14 | 120 | Protein lin-54 homolog |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP011975 | 2e-98 | AP011975.1 Jatropha curcas DNA, clone: JHL25H03, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020535281.1 | 1e-100 | protein tesmin/TSO1-like CXC 3 isoform X1 | ||||
Refseq | XP_020535282.1 | 1e-100 | protein tesmin/TSO1-like CXC 3 isoform X2 | ||||
Refseq | XP_020535283.1 | 1e-100 | protein tesmin/TSO1-like CXC 3 isoform X3 | ||||
Refseq | XP_020535284.1 | 1e-101 | protein tesmin/TSO1-like CXC 3 isoform X4 | ||||
Swissprot | F4JIF5 | 7e-56 | TCX2_ARATH; Protein tesmin/TSO1-like CXC 2 | ||||
TrEMBL | B9RV08 | 1e-85 | B9RV08_RICCO; Tso1, putative | ||||
STRING | XP_002517577.1 | 2e-86 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14277 | 14 | 17 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14770.1 | 3e-58 | TESMIN/TSO1-like CXC 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|