 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Jcr4S00229.90 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
| Family |
YABBY |
| Protein Properties |
Length: 125aa MW: 13943 Da PI: 8.8451 |
| Description |
YABBY family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Jcr4S00229.90 | genome | Kazusa | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | YABBY | 59.7 | 1.2e-18 | 10 | 54 | 2 | 46 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsll 46
d++ se++Cyv+CnfCnt+lav +P + l+ +vtv+CGhC++l
Jcr4S00229.90 10 DLVPPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLS 54
78899*************************************984 PP
|
| 2 | YABBY | 86.4 | 7.8e-27 | 61 | 109 | 115 | 163 |
YABBY 115 virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
+ Pek+ r Psaynrf+keeiqrika+nP+i hreafs+aaknWa +
Jcr4S00229.90 61 PLQAPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSTAAKNWARY 109
4688*******************************************76 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AY854804 | 2e-51 | AY854804.1 Gossypium hirsutum isolate 1 CRABS CLAW mRNA, partial cds. |
| GenBank | AY854805 | 2e-51 | AY854805.1 Gossypium hirsutum isolate 2 CRABS CLAW mRNA, partial cds. |
| Publications
? help Back to Top |
- Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C
The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development.
Ann. Bot., 2014. 114(7): p. 1535-44
[PMID:24989787] - Pfannebecker KC,Lange M,Rupp O,Becker A
Seed Plant-Specific Gene Lineages Involved in Carpel Development.
Mol. Biol. Evol., 2017. 34(4): p. 925-942
[PMID:28087776] - Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T
Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation.
Nat Commun, 2017. 8(1): p. 1125
[PMID:29066759] - Yamaguchi N, et al.
Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy.
Nat Commun, 2018. 9(1): p. 5290
[PMID:30538233]
|
