PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S00157.100 | ||||||||
Common Name | JCGZ_00716, LOC105633208 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 10030.6 Da PI: 10.4372 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.9 | 1.3e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++l+ +++++G g+W+t ++ g++R++k+c++rw +yl Jcr4S00157.100 14 KGPWTSEEDQKLIAYIQKHGHGRWRTLPKNAGLKRCGKSCRLRWTNYL 61 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 7.1E-28 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.607 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.58E-24 | 15 | 86 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.65E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.6E-8 | 65 | 86 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.469 | 66 | 87 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MAKSSCCDKN GLKKGPWTSE EDQKLIAYIQ KHGHGRWRTL PKNAGLKRCG KSCRLRWTNY 60 LRPDIKRGKF SVEEEDAIIQ LHSVFGK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-17 | 12 | 86 | 25 | 98 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM034724 | 3e-68 | KM034724.1 Jatropha curcas clone JcMYB104 MYB family protein gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012071180.1 | 6e-60 | transcription factor MYB34 | ||||
Swissprot | Q9LDR8 | 3e-52 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A067L4D3 | 1e-58 | A0A067L4D3_JATCU; MYB family protein | ||||
STRING | EOY12766 | 1e-52 | (Theobroma cacao) | ||||
STRING | XP_002525779.1 | 5e-53 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 1e-54 | MYB-like 102 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105633208 |
Publications ? help Back to Top | |||
---|---|---|---|
|