![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S00096.110 | ||||||||
Common Name | JCGZ_20471 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 10642 Da PI: 5.7751 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.5 | 3e-08 | 30 | 68 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++++E++l+++ + G++ W++Ia +++ gR ++++ +w Jcr4S00096.110 30 MSEQEEDLIYRMYSLVGNR-WELIAGRIP-GRKAEEIERFW 68 699****************.*********.*********99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 8.1E-6 | 26 | 74 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.64E-5 | 29 | 68 | No hit | No description |
Pfam | PF00249 | 1.5E-7 | 30 | 69 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-10 | 31 | 69 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.42E-7 | 31 | 70 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MDERPWKKQK TCSSCRSEEV SSVEWEFIEM SEQEEDLIYR MYSLVGNRWE LIAGRIPGRK 60 AEEIERFWIM KHNQEFANKR NQHQPSY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU181427 | 3e-31 | EU181427.1 Vitis vinifera Myb-related TRIPTYCHON-like protein (TRY) mRNA, complete cds. | |||
GenBank | FQ385522 | 3e-31 | FQ385522.1 Vitis vinifera clone SS0AEB31YP12. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012086747.1 | 2e-59 | transcription factor CPC isoform X2 | ||||
Swissprot | Q8GV05 | 6e-33 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A067JZ93 | 6e-58 | A0A067JZ93_JATCU; Uncharacterized protein | ||||
STRING | XP_006491245.1 | 3e-36 | (Citrus sinensis) | ||||
STRING | EOY24982 | 2e-36 | (Theobroma cacao) | ||||
STRING | XP_008791027.1 | 3e-36 | (Phoenix dactylifera) | ||||
STRING | XP_006444875.1 | 3e-36 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3583 | 27 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 6e-25 | MYB_related family protein |