PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S00011.130

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

NAC

Protein Properties

Length: 90aa MW: 10570.1 Da PI: 9.7768

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S00011.130	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	53.8	6.6e-17	6	60	73	128
NAM 73 rknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 r+n+++ +g+Wkatg d ++ s + vg k+tLv+++ + ++++kt+W+mhey++ Jcr4S00011.130 6 RPNQKACNGFWKATGADVHIRS-NMLIVGYKTTLVYFEDNPKESTKTNWIMHEYKI 60 78898999***********9.9999*************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	24.422	1	88	IPR003441	NAC domain
SuperFamily	SSF101941	1.57E-22	3	87	IPR003441	NAC domain
Pfam	PF02365	1.6E-8	8	60	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MSKWVRPNQK ACNGFWKATG ADVHIRSNML IVGYKTTLVY FEDNPKESTK TNWIMHEYKI 60 DKRSPSSANR TPGDMKLDNW VLCKVYNREE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-18	6	89	88	166	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-18	6	89	88	166	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-18	6	89	88	166	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-18	6	89	88	166	NO APICAL MERISTEM PROTEIN
3swm_A	1e-18	6	89	91	169	NAC domain-containing protein 19
3swm_B	1e-18	6	89	91	169	NAC domain-containing protein 19
3swm_C	1e-18	6	89	91	169	NAC domain-containing protein 19
3swm_D	1e-18	6	89	91	169	NAC domain-containing protein 19
3swp_A	1e-18	6	89	91	169	NAC domain-containing protein 19
3swp_B	1e-18	6	89	91	169	NAC domain-containing protein 19
3swp_C	1e-18	6	89	91	169	NAC domain-containing protein 19
3swp_D	1e-18	6	89	91	169	NAC domain-containing protein 19
4dul_A	1e-18	6	89	88	166	NAC domain-containing protein 19
4dul_B	1e-18	6	89	88	166	NAC domain-containing protein 19
Search in ModeBase

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015389322.1	5e-25	NAC transcription factor 32-like
TrEMBL	A0A067ES30	2e-23	A0A067ES30_CITSI; Uncharacterized protein
TrEMBL	A0A067F1I4	4e-24	A0A067F1I4_CITSI; Uncharacterized protein (Fragment)
TrEMBL	A0A2H5QXH1	6e-24	A0A2H5QXH1_CITUN; Uncharacterized protein
STRING	XP_006446143.1	2e-23	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF17306	5	7

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	3e-23	NAC-like, activated by AP3/PI