 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Itr_sc003127.1_g00001.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
| Family |
WOX |
| Protein Properties |
Length: 55aa MW: 6503.61 Da PI: 11.1733 |
| Description |
WOX family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Itr_sc003127.1_g00001.1 | genome | Kazusa | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 21.7 | 3.4e-07 | 2 | 36 | 5 | 38 |
SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHCT CS
Homeobox 5 ttftkeqleeLeelFek.nrypsaeereeLAkklg 38
+++++eq+++Le+lF++ +ps e++++ kl+
Itr_sc003127.1_g00001.1 2 WNPKPEQIRILESLFNSgVVNPSWEKIRRVRIKLE 36
99**************99**********9988875 PP
|
| 2 | Wus_type_Homeobox | 57 | 4.7e-19 | 2 | 41 | 6 | 45 |
Wus_type_Homeobox 6 WtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGki 45
W+P+peQi+iLe+l++sG+++P+ e+i+r++ +LeeyGk+
Itr_sc003127.1_g00001.1 2 WNPKPEQIRILESLFNSGVVNPSWEKIRRVRIKLEEYGKV 41
***************************************9 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Homeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}. |
| Publications
? help Back to Top |
- Wang W, et al.
Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
PLoS Genet., 2014. 10(3): p. e1004154
[PMID:24625559] - Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce.
J. Exp. Bot., 2014. 65(22): p. 6543-52
[PMID:25205582] - Raines T, et al.
The cytokinin response factors modulate root and shoot growth and promote leaf senescence in Arabidopsis.
Plant J., 2016. 85(1): p. 134-47
[PMID:26662515] - Dolzblasz A, et al.
Stem Cell Regulation by Arabidopsis WOX Genes.
Mol Plant, 2016. 9(7): p. 1028-39
[PMID:27109605] - Blein T,Pautot V,Laufs P
Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
Plants (Basel), 2013. 2(2): p. 230-47
[PMID:27137374]
|
