PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

NAC

Protein Properties

Length: 262aa MW: 30000.1 Da PI: 8.2749

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc003030.1_g00004.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	114.7	9.8e-36	6	121	14	128
NAM 14 lvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkdkevlskk 96 lvv+yL++kv++k++++ e+i+ vdiyk+ePw+L++ +v+++++ewyf + +kky+ ++ n+ +t++gyWk++ kd++v + k Itr_sc003030.1_g00004.1 6 LVVYYLRRKVRRKPFHV-EAIAVVDIYKHEPWELHAfcAVNTTDQEWYFLVGFEKKYKGSRLINKsSTEKGYWKTSEKDQTVSH-K 89 99*************.89**********94457888999********9877788879***********99.8 PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 +e vg+kktLv++ g+ p+g++t+Wvmheyrl Itr_sc003030.1_g00004.1 90 REIVGMKKTLVYHAGKPPNGRRTNWVMHEYRL 121 999*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	39.059	1	145	IPR003441	NAC domain
SuperFamily	SSF101941	3.66E-39	6	145	IPR003441	NAC domain
Pfam	PF02365	1.1E-16	6	121	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 262 aa Download sequence Send to blast
MNPSPLVVYY LRRKVRRKPF HVEAIAVVDI YKHEPWELHA FCAVNTTDQE WYFLVGFEKK 60 YKGSRLINKS STEKGYWKTS EKDQTVSHKR EIVGMKKTLV YHAGKPPNGR RTNWVMHEYR 120 LVEAELDKAG VEQDDSFMLC KIFCKNEMGP PCSGVYGPFN EEDWENDEVR QAGRVYKQRN 180 TKNRLKFDLF PSNKCVSSDE ASSLSTDVPV PSSGLLNFSL SAQPNLENHS HLPPPPKVVG 240 AFDSSCLEKS VQCLQAISQV HE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-26	6	146	30	166	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-26	6	146	30	166	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-26	6	146	30	166	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-26	6	146	30	166	NO APICAL MERISTEM PROTEIN
3swm_A	2e-26	6	146	33	169	NAC domain-containing protein 19
3swm_B	2e-26	6	146	33	169	NAC domain-containing protein 19
3swm_C	2e-26	6	146	33	169	NAC domain-containing protein 19
3swm_D	2e-26	6	146	33	169	NAC domain-containing protein 19
3swp_A	2e-26	6	146	33	169	NAC domain-containing protein 19
3swp_B	2e-26	6	146	33	169	NAC domain-containing protein 19
3swp_C	2e-26	6	146	33	169	NAC domain-containing protein 19
3swp_D	2e-26	6	146	33	169	NAC domain-containing protein 19
4dul_A	2e-26	6	146	30	166	NAC domain-containing protein 19
4dul_B	2e-26	6	146	30	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269\|PubMed:19237690, ECO:0000269\|PubMed:24045019, ECO:0000269\|PubMed:25578968, ECO:0000269\|PubMed:26617990, ECO:0000269\|PubMed:28207953}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269\|PubMed:16553893}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019196370.1	2e-74	PREDICTED: NAC domain-containing protein 82-like
Swissprot	Q9SQY0	4e-56	NAC52_ARATH; NAC domain containing protein 52
TrEMBL	A0A2J6M5L4	4e-58	A0A2J6M5L4_LACSA; Uncharacterized protein

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA6050	23	34

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G10490.1	9e-54	NAC domain containing protein 52

Publications ? help Back to Top
Higgins JD,Ferdous M,Osman K,Franklin FC The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis. Plant J., 2011. 65(3): p. 492-502 [PMID:21265901] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhang S, et al. C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association. Cell Discov, 2019. [PMID:26617990] Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation. Plant J., 2017. 90(3): p. 505-519 [PMID:28207953] Elmayan T, et al. Arabidopsis mutants impaired in cosuppression. Plant Cell, 1998. 10(10): p. 1747-58 [PMID:9761800]