PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc002401.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 161aa MW: 17730.9 Da PI: 10.4489 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 95.3 | 7e-30 | 80 | 133 | 4 | 58 |
CBFB_NFYA 4 lYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 ++VNaKQy++Il+RRq+Rakl ++++l k+rkpy+heSRh hA++R RgsgGrF Itr_sc002401.1_g00002.1 80 IFVNAKQYHGILRRRQMRAKLVAQNRL-LKTRKPYMHESRHLHAVNRVRGSGGRF 133 8**************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 7.5E-32 | 75 | 136 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 33.184 | 76 | 136 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.2E-20 | 79 | 101 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.3E-25 | 80 | 133 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.2E-20 | 110 | 133 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MRPAFLVDNL EVSTNSNSSQ KAETGQATST ILHSSYNCSE DDPNFNGLIF TAYGTQPHEV 60 VGFSSARLPL PFDVADDGLI FVNAKQYHGI LRRRQMRAKL VAQNRLLKTR KPYMHESRHL 120 HAVNRVRGSG GRFLSSKKAH HLDSPSSSPN SLQASTSAIA P |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 9e-20 | 80 | 152 | 5 | 75 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019173376.1 | 1e-76 | PREDICTED: nuclear transcription factor Y subunit A-8-like isoform X2 | ||||
Refseq | XP_019173377.1 | 1e-76 | PREDICTED: nuclear transcription factor Y subunit A-8-like isoform X2 | ||||
Swissprot | Q9SYH4 | 2e-36 | NFYA5_ARATH; Nuclear transcription factor Y subunit A-5 | ||||
TrEMBL | M0ZH82 | 1e-45 | M0ZH82_SOLTU; Uncharacterized protein | ||||
STRING | Solyc12g009050.1.1 | 2e-46 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5009 | 23 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54160.1 | 1e-38 | nuclear factor Y, subunit A5 |