![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc002395.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 94aa MW: 10543.5 Da PI: 4.5099 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 102.5 | 3e-32 | 1 | 63 | 35 | 97 |
NF-YB 35 vqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +qec+sefisfvt+eas+kcq+e+rkt+ngdd++wal++lGf+ y+e+++ yl+k+re e+++ Itr_sc002395.1_g00001.1 1 MQECASEFISFVTGEASEKCQKENRKTVNGDDICWALSSLGFDVYAEAMTRYLHKFREYERQR 63 79**********************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00615 | 1.9E-17 | 1 | 19 | No hit | No description |
SuperFamily | SSF47113 | 8.38E-24 | 1 | 77 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 4.2E-31 | 1 | 77 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-13 | 1 | 37 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PROSITE pattern | PS00685 | 0 | 4 | 20 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.9E-17 | 20 | 38 | No hit | No description |
PRINTS | PR00615 | 1.9E-17 | 39 | 57 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MQECASEFIS FVTGEASEKC QKENRKTVNG DDICWALSSL GFDVYAEAMT RYLHKFREYE 60 RQRANQTKGA SSNDDDGSPC SQPDKQTAGE TAYI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 8e-25 | 1 | 58 | 35 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-25 | 1 | 58 | 35 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019158596.1 | 4e-54 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O04027 | 6e-32 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A1J6KBZ1 | 1e-40 | A0A1J6KBZ1_NICAT; Nuclear transcription factor y subunit b-4 | ||||
STRING | XP_009760265.1 | 8e-41 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 2e-34 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|