![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc001868.1_g00009.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 100aa MW: 11178.7 Da PI: 9.8271 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 22.8 | 1.6e-07 | 23 | 59 | 18 | 54 |
HHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 18 safeeLrellPkaskapskKlsKaeiLekAveYIksL 54 + ++L++llP++ + +s K s +L+++++YI++L Itr_sc001868.1_g00009.1 23 QLVSKLQQLLPELRSRRSAKASAGKVLQETCNYIRNL 59 56689*******779********************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.280.10 | 2.9E-8 | 3 | 77 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
PROSITE profile | PS50888 | 10.372 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 7.46E-8 | 19 | 79 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 7.8E-5 | 20 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MSSRRSRQSS SASSRISDDQ IIQLVSKLQQ LLPELRSRRS AKASAGKVLQ ETCNYIRNLH 60 KEVDDLSDRL SQLLSTIDAD TPEAAIIRSL IIYLLSGLNH |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016559055.1 | 3e-50 | PREDICTED: transcription factor PRE6-like | ||||
Swissprot | Q9LJX1 | 1e-39 | PRE5_ARATH; Transcription factor PRE5 | ||||
TrEMBL | A0A1U8FK00 | 7e-49 | A0A1U8FK00_CAPAN; Transcription factor PRE5 | ||||
TrEMBL | A0A2G2XD16 | 7e-49 | A0A2G2XD16_CAPBA; Transcription factor PRE5 | ||||
TrEMBL | A0A2G3A645 | 7e-49 | A0A2G3A645_CAPAN; transcription factor PRE6-like | ||||
STRING | PGSC0003DMT400017748 | 8e-49 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA353 | 24 | 161 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 2e-24 | bHLH family protein |