![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc001336.1_g00006.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 156aa MW: 16872.8 Da PI: 10.1611 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48 | 2.7e-15 | 84 | 142 | 3 | 61 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 ++k +r+ +NR++A+ R+RKka++ Le kvkeLe++N +L ++l++l++e + l+ Itr_sc001336.1_g00006.1 84 ADKENKRLLRNRVSAQQARERKKAYLTDLEAKVKELETKNAELEERLSTLQNENQMLRH 142 799***************************************************98865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.3E-14 | 82 | 146 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.208 | 84 | 147 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.8E-14 | 84 | 143 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.19E-13 | 86 | 144 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 7.9E-17 | 86 | 146 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 89 | 104 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14704 | 1.07E-15 | 89 | 138 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MQEQAAVSSV AAKFIPSSSE RSSSSALHLE VKEGMESDDE IRRVPEMGGE GGAAPAASGR 60 DGVSAAGTAQ PSGAAQKKRG RSPADKENKR LLRNRVSAQQ ARERKKAYLT DLEAKVKELE 120 TKNAELEERL STLQNENQML RHILKNTTAG SQEARK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2oqq_A | 3e-16 | 107 | 146 | 3 | 42 | Transcription factor HY5 |
2oqq_B | 3e-16 | 107 | 146 | 3 | 42 | Transcription factor HY5 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019153781.1 | 2e-84 | PREDICTED: transcription factor HY5-like | ||||
Swissprot | Q9SM50 | 6e-79 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | A0A1U8E2N7 | 4e-77 | A0A1U8E2N7_CAPAN; Transcription factor HY5 | ||||
TrEMBL | A0A2G2W566 | 4e-77 | A0A2G2W566_CAPBA; Uncharacterized protein | ||||
TrEMBL | A0A2G2ZY99 | 4e-77 | A0A2G2ZY99_CAPAN; transcription factor HY5 | ||||
TrEMBL | A0A2G3CVK7 | 4e-77 | A0A2G3CVK7_CAPCH; Transcription factor HY5 | ||||
STRING | Solyc08g061130.2.1 | 2e-77 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA8037 | 24 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 1e-50 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|