![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc001225.1_g00005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 103aa MW: 11244.7 Da PI: 4.8679 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 86.7 | 3e-27 | 38 | 97 | 2 | 61 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl k+y++++d+++++++sws ++nsfvv+d+ efak++LpkyFkh+nf+SFvRQLn+Y Itr_sc001225.1_g00005.1 38 FLVKTYDMVDDPSTDKIVSWSPTNNSFVVWDPPEFAKDLLPKYFKHNNFSSFVRQLNTYI 97 9********************999***********************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.9E-30 | 29 | 98 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 2.3E-25 | 34 | 98 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 5.17E-26 | 36 | 97 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 1.2E-17 | 38 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 2.5E-23 | 38 | 97 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.2E-17 | 76 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.2E-17 | 89 | 101 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MELNSSSGGK GAAAGDGAQP SLPPQPAPMP STNSPPPFLV KTYDMVDDPS TDKIVSWSPT 60 NNSFVVWDPP EFAKDLLPKY FKHNNFSSFV RQLNTYIYPI LGL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 1e-22 | 22 | 98 | 14 | 89 | Heat shock factor protein 1 |
5d5v_B | 1e-22 | 22 | 98 | 14 | 89 | Heat shock factor protein 1 |
5d5v_D | 1e-22 | 22 | 98 | 14 | 89 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019182005.1 | 9e-62 | PREDICTED: heat shock factor protein HSF8-like | ||||
Refseq | XP_019182006.1 | 9e-62 | PREDICTED: heat shock factor protein HSF8-like | ||||
Swissprot | Q40152 | 2e-37 | HSF8_SOLLC; Heat shock factor protein HSF8 | ||||
TrEMBL | A0A314L0P4 | 2e-42 | A0A314L0P4_NICAT; Heat shock factor protein hsf8 | ||||
STRING | XP_009781208.1 | 7e-43 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA572 | 24 | 113 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17750.1 | 5e-34 | heat shock factor 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|